PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009608553.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 376aa    MW: 42425.4 Da    PI: 6.1657
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009608553.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.9e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
   XP_009608553.1 14 KGPWSPEEDATLKAYIEENGTGnNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.82.1e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
   XP_009608553.1  69 GGFTEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.137962IPR017930Myb domain
SuperFamilySSF466895.01E-2611109IPR009057Homeodomain-like
SMARTSM007179.0E-121364IPR001005SANT/Myb domain
PfamPF002492.4E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-241569IPR009057Homeodomain-like
CDDcd001672.88E-81662No hitNo description
PROSITE profilePS5129422.10963117IPR017930Myb domain
SMARTSM007172.3E-1167115IPR001005SANT/Myb domain
PfamPF002496.3E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2370117IPR009057Homeodomain-like
CDDcd001676.98E-871111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MGRAPCCDKN NVKKGPWSPE EDATLKAYIE ENGTGNNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FTEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
RKQSQMNRLL LASGGQDLKE TNGLEENSLF QNLSNSALER LQLHMQLQTL QNPLSFYNNP  180
ALWPKLTPLQ QKMIQTLQAN GLNESQSPIF APINPSDNQA HELGQKVVIN EFANTMTNFK  240
VNEVEKSTTN KGISSSDSTP IVSNNQRNVL DKNIGQENTR EIQVQIQGVQ GFTQAEIDDL  300
ILNKGIGFNL PSENHQIAEF DCFKEMDDGS RDNLAWWSNE FDTNTASSSN SWGSSSNIFQ  360
QTEGMYQDYA LGYNLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22141177108B-MYB
1h8a_C2e-221411727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754461e-157HG975446.1 Solanum pennellii chromosome ch07, complete genome.
GenBankHG9755191e-157HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608553.10.0PREDICTED: myb-related protein 306
RefseqXP_016458757.10.0PREDICTED: transcription factor MYB36-like
SwissprotQ9FKL21e-100MYB36_ARATH; Transcription factor MYB36
TrEMBLK4CBE60.0K4CBE6_SOLLC; Uncharacterized protein
STRINGSolyc07g006750.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.15e-94myb domain protein 36